GEN220_2020

2020 Edition of the Class

Project maintained by biodataprog Hosted on GitHub Pages — Theme by mattgraham

Command Line interactions and tools

reminder of some tools

wc - count the number of lines,words,characters
tail - see the last N lines of a file
head - see the first N lines of a file
cat - print out entire file to screen
sed - ‘stream editor’ - edit data stream on the fly
curl - downloading tool for web/ftp data streams
which - list path to a program based on the $PATH
pwd - print the current working directory
ps - processes running on the system
man - view manual pages about a command or program
date - date and time
time - prefix a command/program, report how long it took to run
find - find files/folders by name or other property
du - reports disk usage (e.g. how big a file or folder is)
awk - a simple language for processing files/great for column delimited data

Reminder of some commands while at the command line

^ means “Control key”
cancel a running application: ^C
end a session: ^D (End of File message)
Tab to try to autocomplete (applications, filenames, directories)
While typing on cmdline - jump to end of line: ^E
Get back to the beginning of line: ^A
Up and down keys cycle through history of commands
Type !! to execute the last command
Type history to see list of previous commands
Type !NUMBER to excute cmd from that list
Type !g to run the last command that started with g

Processes

UNIX allows multiple processes (programs) to be run at the same time. While at the command line you can run a specific process, but your command line will be blocked until that program is finished.

Try this which will run a task which just pauses for 30 seconds.

sleep 30

Jobs are run in the foreground by default. While a job is running use ^Z to suspend job.

sleep 30
^Z
[1]+  Stopped                 sleep 30

To keep the job running but put it in the background use the command bg which will puts process in background.

$ bg
[1]+ sleep 30 &

If you want to put the job back in the foreground so you can interact with it or force cancel it use the command fg.

$ fg
fg
sleep 30

To launch a job directly into the background put an & at the end.

$ sleep 30 &

It can still be brought to the foreground with fg.

A typical use if you are using a tool which generates graphical interface that you will interact with is to launch it in background. It will print out the process id of the command that is running.

$ emacs &
[1] 25341

More file manipulation

Copying files

To copy a file use the command cp.

$ touch one.txt  # create an empty file
$ cp one.txt two.txt# copy one file to another
$ mkdir books # make a directory
$ cp one.txt books        # copy into a directory
$ ls books                # list the contents
one.txt
$ cp books more_books     # copy the folder, will fail
cp: books is a directory (not copied).
$ cp -r books more_books  # recursive copy succeeds
$ cp one.txt two.txt books # can copy more than one at a time
                           # will also OVERWRITE the previous
                           # one.txt that was in the folder
$ ls books
$ ls more_books

The command rsync can also be used to copy files between folders or between computers.

Here we copy a file that is located on your laptop called LOCALFILE onto the HPCC and will put it in the folder bigdata which is located in your home directory.

[your laptop] $ rsync -a --progress LOCALFILE USER@cluster.hpcc.ucr.edu:bigdata/

Can also specify an explicit path (starts with /).

[your laptop] $ rsync -a --progress LOCALFILE USER@cluster.hpcc.ucr.edu:/bigdata/gen220/USER/

Can copy FROM HPCC to your local computer

[your laptop] $ rsync -a --progress USER@cluster.hpcc.ucr.edu:/bigdata/gen220/share/simple/yeast_gene_names.txt .

Moving files

Moving files is just renaming them.

$ mv one.txt three.txt     # rename one.txt to three.txt
$ mv three.txt books       # relocate three.txt to books folder
$ cd books
$ mv one.txt two.txt three.txt .. # move these files back UP one
directory
$ ls                       # nothing in the 'books' directory
$ cd ..                    # go back
$ ls                       # these files are in the current folder
one.txt two.txt three.txt books more_books
$ ls books                 # is now empty, we moved everything
                           # out of there

Running programs

How does UNIX determine what program to run?

Try typing echo $PATH to see your search directory. Also do env to see all environment variables.

You can use the command which to tell you where a program is located

which nano # will tell you where the nano program
           # is located

Useful utility - grep

To search a file for matches the grep command is really useful and powerful. Here we will show a short example with more details later.

Output from programs

Remember that we can redirect output with > which will overwrite a file and >> will append to end. If we want instead of storing it we wanted to pass the output from one program into another we use the | or pipe.

For example - count how many words and letters are in this message:

echo "This is a long sentence" | wc

Let’s get a few datasets together and try out some simple tools.

If you haven’t already checked out the github data repository for the class examples do this:

git clone https://github.com/biodataprog/GEN220_data.git

You can also browse this dataset https://github.com/biodataprog/GEN220_data

Now lets run some basic UNIX tools on these data.

cd GEN220_data
ls # see what is in the folder, notice there is a 'data' folder
cd data
# take a look at one of the files
more codon_table.txt # Also see it here https://github.com/biodataprog/GEN220_data/blob/main/data/codon_table.txt
# let's see how many codons are in the codon table
wc -l codon_table.txt
# now let's see how many codons there are which code for Valine
grep Valine codon_table.txt # see how many show up
# now lets just report the count of the number in there
grep Valine codon_table.txt | wc -l
# note that grep is also really useful - you can tell it just to report the number of lines so
# the following also works
grep -c Valine codon_table.txt
# can pass to sort program if you want as another way to show this
grep cine codon_table.txt
grep cine codon_table.txt | sort

Running Bioinformatics Programs

On the UCR HPCC there are many installed applications through a UNIX module system. To load a module means to make that program part of your path and in some cases will set other environment variables.

For example to get access to the BLAST suite.

$ which blastn
/usr/bin/which: no blastn in ....

$ module load ncbi-blast
$ which blastn
/opt/linux/centos/7.x/x86_64/pkgs/ncbi-blast/2.2.30+/bin/blastn

There are multiple versions installed on the system

module avail ncbi-blast

---- /opt/linux/centos/7.x/x86_64/modules ----------------------------
ncbi-blast/2.2.22+          ncbi-blast/2.2.30+(default) ncbi-blast/2.6.0+
ncbi-blast/2.2.25+          ncbi-blast/2.2.31+          ncbi-blast/2.7.1+
ncbi-blast/2.2.26           ncbi-blast/2.3.0+           ncbi-blast/2.8.0+
ncbi-blast/2.2.26+          ncbi-blast/2.4.0+           ncbi-blast/2.8.1+
ncbi-blast/2.2.29+          ncbi-blast/2.5.0+           ncbi-blast/2.9.0+

You can load a specific version

module load ncbi-blast/2.9.0+
which blastn
/opt/linux/centos/7.x/x86_64/pkgs/ncbi-blast/2.9.0+/bin/blastn
module unload ncbi-blast
/usr/bin/which: no blastn in ....

See what versions of modules you currently have loaded

module list
Currently Loaded Modulefiles:
  1) slurm/19.05.0                 4) texlive/2017                  7) geos/3.7.1                   10) R/3.6.0                      13) iigb_utilities/1             16) miniconda3/4.3.31
  2) openmpi/4.0.1-slurm-19.05.0   5) pandoc/2.0                    8) gdal/2.1.3                   11) perl/5.20.2                  14) pbzip2/1.1.12                17) neovim/0.2.1
  3) ggobi/2.1.11                  6) netcdf/4.4.1.1                9) hdf5/1.10.1                  12) less-highlight/1.0           15) parallel/20151222            18) ncbi-blast/2.9.0+

Running programs

curl is useful downloading from remote sites. URLs either FTP, HTTP, or HTTPS.

 $ curl https://www.uniprot.org/uniprot/E3Q6S8.fasta
 >tr|E3Q6S8|E3Q6S8_COLGM RNAse P Rpr2/Rpp21/SNM1 subunit domain-containing protein
OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_02386 PE=4 SV=1
MAKPKSESLPNRHAYTRVSYLHQAAAYLATVQSPTSDSTTNSSQPGHAPHAVDHERCLET
NETVARRFVSDIRAVSLKAQIRPSPSLKQMMCKYCDSLLVEGKTCSTTVENASKGGKKPW
ADVMVTKCKTCGNVKRFPVSAPRQKRRPFREQKAVEGQDTTPAVSEMSTGAD
$ curl -OL https://www.uniprot.org/uniprot/E3Q6S8.fasta

% Total    % Received % Xferd  Average Speed   Time    Time     Time  Current
                           Dload  Upload   Total   Spent    Left  Speed
100   345  100   345    0     0    724      0 --:--:-- --:--:-- --:--:--   724

$ curl -o myseqfile.fa  https://www.uniprot.org/uniprot/E3Q6S8.fasta

Often use the -L in curl to allow URL redirects. There are also resuming options (-C) and ways to pass in username/password for authenticated sites. Also

wget - also gets web/FTP on commandline
ncftpget - for ftp
lftp - a command line FTP client - also works for http/web

Redirect output and input

> - write out the output to file (create it if empty, and overwrite if exists)

$ curl https://www.uniprot.org/uniprot/E3Q6S8.fasta > E3Q6S8.fa

>> - write out output to a file (create it if empty) but append to the end of the file

$ echo "my name is " >> what_is_my name
$ echo "Joe" >> what_is_my_name
$ cat what_is_my_name
my name is
Joe

< - This is for redirecting INPUT from a file. We’ll talk about this more but is how we might pull a set of commands into a program expecting input

$ R --no-save < My_R_commands.R

Compression

File compression can save disk space, reduce file transfer time when copying between computers

gzip for GNUzip compression. Single file at a time.
pigz is parallelized and can use multiple processors

$ pigz file.txt

$ du -h data/Nc20H.expr.tab        # report how big the file is
656K    data/Nc20H.expr.tab
$ pigz data/Nc20H.expr.tab         # to compress
$ du -h data/Nc20H.expr.tab.gz     # report size of compressed file
236K    data/Nc20H.expr.tab.gz
$ pigz -d data/Nc20H.expr.tab.gz    # to uncompress

bzip2 for Bzip compression. Better compression than gzip but slower.
pbzip2 is parallelized and can use multiple processors

$ module load pbzip2
$ bzip2 data/Nc20H.expr.tab        # compress with bzip2
$ du -h data/Nc20H.expr.tab.bz2    # report size of bzipped file
204K    data/Nc20H.expr.tab.bz2
$ bunzip2 data/Nc20H.expr.tab.bz2

zcat, zmore and bzcat, bzmore to read compressed files on the fly

$ zmore file.gz

Disk space usage of files

du - disk usage

-h – show result in human readable output (eg butes, Kilobytes, Gigabytes) $ –time - show time of last update

$ du -h /bigdata/gen220/shared/data_files/S_cerevisiae_ORFs.fasta
11M	/bigdata/gen220/shared/data_files/S_cerevisiae_ORFs.fasta
$ du /bigdata/gen220/shared/data_files/S_cerevisiae_ORFs.fasta
10752	/bigdata/gen220/shared/data_files/S_cerevisiae_ORFs.fasta
$ du -h --time /bigdata/gen220/shared/data_files/S_cerevisiae_ORFs.fasta

Can also be used on folders to summarize the total size of contents of a folder.

Running programs

The pipe operator | allows you to instead of redirecting output to a file, redirect it to another program. Specifically the STDIN of the other program. This is very powerful and allows you to chain together different processes

$ zcat data/Nc20H.expr.tab.gz | wc -l
# output from zcat is printed to STDOUT and that is redirected
# to the command wc with the -l option which in turn
# expects input on STDIN.
# Output from a program can be fed to a pager like less
$ blastn -help | less
$ fasta36 query db | more
$ fasta36 query db | tee report.out | more

tee is a program which reads from STDIN and writes this BOTH to a file and to STDOUT. A way to monitor a program but to also detach from reading the messages and still capture it all to a file.

Multiple pipes can be used, and building together we can start to construct a series of queries. Will go into this more in detail in the next lecture but here we process a file and capture

# shows top ten results from a blast report
$ zcat data/blast.out.gz | head -n 10

# returns the total number of unique items found in column 1
$ zcat data/blast.out.gz | awk '{print $1}' | sort | uniq | wc -l

# take output from blast program, compress it on the fly to a new file
$ blastn -query query.fa -db db.fa -outfmt 6 | gzip -c > blastresult.gz

Using the HPCC cluster

On Biocluster there are a couple of folder structures to understand

/rhome/USERNAME your home directory - limited space (20gb)
/bigdata/labname/USERNAME your ‘bigdata’ folder (bigger space (100gb+)
/bigdata/labname/shared shared folder space for your lab

Currently everyone is in the the gen220 ‘lab’ during this course so you have access to /bigdata/gen220/shared and /bigdata/gen220/USERNAME

How much data am I using currently: https://dashboard.hpcc.ucr.edu

/scratch - local space on a cluster node which is FAST disk access but temporary (30 days)

Transferring data

Graphical tools: Filezilla - https://filezilla-project.org/download.php

Command-line:

# interactive FTP client
$ sftp USERNAME@cluster.hpcc.ucr.edu
# copy a file
$ scp USERNAME@cluster.hpcc.ucr.edu:fileoncluster.txt ./file-on-your-machine.txt
# copy a folder, recursively
$ scp -r USERNAME@cluster.hpcc.ucr.edu:/bigdata/gen220/shared/simple .
# rsync copies, but can check and only copy changed files
$ rsync -a --progress USERNAME@cluster.hpcc.ucr.edu:/bigdata/gen220/shared/simple .
# copy FROM your computer TO the cluster, swap order - here
# copy a folder back to your HOME directory
$ scp -r simple USERNAME@cluster.hpcc.ucr.edu:

Submitting jobs

Currently only shown login to the main “head” node (cluster.hpcc.ucr.edu)

To use the 6500 CPUs we need to submit job for running. This is called a job management or queueing system.

We use SLURM on the UCR system currently.

We use the SLURM queuing systems on HPCC. Read info here for more resources. http://hpcc.ucr.edu/manuals_linux-cluster_jobs.html

Getting an interactive shell (eg get your own CPU to do work on)

$ srun --pty bash -l
$ srun --nodes 1 --ntasks 2 --mem 8gb --time 8:00:00 --pty bash -l

You can type this in on the cmdline (also click here to see what you will be retrieving )

module load ncbi-blast
module load db-ncbi
curl -O https://www.uniprot.org/uniprot/Q5T6X5.fasta
blastp -num_threads 2 -query Q5T6X5.fasta  -db swissprot -out result.blastp

Batch/non-interactive job

You can also make this a job script (call it job.sh)

#!/bin/bash
module load ncbi-blast
module load db-ncbi
curl -O https://www.uniprot.org/uniprot/Q5T6X5.fasta
blastp -num_threads 2 -query Q5T6X5.fasta  -db swissprot -out result.blastp

Submit it with the following options

$ sbatch -N 1 -n 2 -p short job.sh

Requesting job resources

number of CPUs: –ntasks N OR -n
memory: –mem Xgb
runtime: –time 12:00:00
outputfile: –out results.log

Can also set these INSIDE the script

#!/bin/bash
#SBATCH --nodes 1 --ntasks 2 --mem 2gb --time 2:00:00
module load ncbi-blast
module load db-ncbi
curl -O https://www.uniprot.org/uniprot/Q5T6X5.fasta
blastp -num_threads 2 -query Q5T6X5.fasta  -db swissprot -out result.blastp